![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins) |
![]() | Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (9 species) |
![]() | Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [54460] (5 PDB entries) |
![]() | Domain d1sebe2: 1seb E:1-81 [38177] Other proteins in same PDB: d1seba1, d1sebb1, d1sebd1, d1sebd2, d1sebe1, d1sebf1, d1sebh1, d1sebh2 |
PDB Entry: 1seb (more details), 2.7 Å
SCOP Domain Sequences for d1sebe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sebe2 d.19.1.1 (E:1-81) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1} ikeehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgal aniavdkanleimtkrsnytp
Timeline for d1sebe2: