![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
![]() | Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (18 PDB entries) |
![]() | Domain d1sebb2: 1seb B:1-92 [38176] Other proteins in same PDB: d1seba1, d1seba2, d1sebb1, d1sebd1, d1sebd2, d1sebe1, d1sebe2, d1sebf1, d1sebh1, d1sebh2 |
PDB Entry: 1seb (more details), 2.7 Å
SCOPe Domain Sequences for d1sebb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sebb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]} gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey wnsqkdlleqrraavdtycrhnygvgesftvq
Timeline for d1sebb2: