Lineage for d1sebb2 (1seb B:1-92)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2183369Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2183379Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (18 PDB entries)
  8. 2183404Domain d1sebb2: 1seb B:1-92 [38176]
    Other proteins in same PDB: d1seba1, d1seba2, d1sebb1, d1sebd1, d1sebd2, d1sebe1, d1sebe2, d1sebf1, d1sebh1, d1sebh2

Details for d1sebb2

PDB Entry: 1seb (more details), 2.7 Å

PDB Description: complex of the human mhc class ii glycoprotein hla-dr1 and the bacterial superantigen seb
PDB Compounds: (B:) hla class II histocompatibility antigen

SCOPe Domain Sequences for d1sebb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sebb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d1sebb2:

Click to download the PDB-style file with coordinates for d1sebb2.
(The format of our PDB-style files is described here.)

Timeline for d1sebb2: