Lineage for d1seba2 (1seb A:1-81)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198436Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 1198446Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (15 PDB entries)
    Uniprot P01903 28-207
  8. 1198464Domain d1seba2: 1seb A:1-81 [38175]
    Other proteins in same PDB: d1seba1, d1sebb1, d1sebb2, d1sebd1, d1sebd2, d1sebe1, d1sebf1, d1sebf2, d1sebh1, d1sebh2

Details for d1seba2

PDB Entry: 1seb (more details), 2.7 Å

PDB Description: complex of the human mhc class ii glycoprotein hla-dr1 and the bacterial superantigen seb
PDB Compounds: (A:) hla class II histocompatibility antigen

SCOPe Domain Sequences for d1seba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1seba2 d.19.1.1 (A:1-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
ikeehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgal
aniavdkanleimtkrsnytp

SCOPe Domain Coordinates for d1seba2:

Click to download the PDB-style file with coordinates for d1seba2.
(The format of our PDB-style files is described here.)

Timeline for d1seba2: