Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins) |
Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (10 species) |
Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [54460] (6 PDB entries) |
Domain d1seba2: 1seb A:1-81 [38175] Other proteins in same PDB: d1seba1, d1sebb1, d1sebd1, d1sebd2, d1sebe1, d1sebf1, d1sebh1, d1sebh2 |
PDB Entry: 1seb (more details), 2.7 Å
SCOP Domain Sequences for d1seba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1seba2 d.19.1.1 (A:1-81) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1} ikeehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgal aniavdkanleimtkrsnytp
Timeline for d1seba2: