SCOPe 2.07: Domain d6jktc2: 6jkt C:158-326

Lineage for d6jktc2 (6jkt C:158-326)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (26 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:353153] [226636] (7 PDB entries)

8. Domain d6jktc2: 6jkt C:158-326 [381738]
   Other proteins in same PDB: d6jkta3, d6jktb3, d6jktd3, d6jkte3
   automated match to d4iv5a2
   complexed with gol, pal

Details for d6jktc2

PDB Entry: 6jkt, 2.3 Å

PDB Description: crystal structure of aspartate transcarbamoylase from trypanosoma cruzi in complex with n-(phosphonacetyl)-l-aspartic acid (pala).

PDB Compounds: (C:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d6jktc2:

Sequence; same for both SEQRES and ATOM records:

>d6jktc2 c.78.1.0 (C:158-326) automated matches {Trypanosoma cruzi [TaxId: 353153]}
svdgitialigdlkmgrtvhsllkllvrnfsikcvflvapdalqmpqdvleplqheiatk
gviihrthaltdevmqksdvlyttrlqkerfmastsddaaalqsfaakaditidaarmrl
akekmivmhplprndelsttvdadpraayfrqmrygmfmrmailwsvla

Timeline for d6jktc2:

• d6jktc2 is new in SCOPe 2.07-stable
  
• d6jktc2 appears in the current release, SCOPe 2.08