| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
| Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
| Protein automated matches [226938] (26 species) not a true protein |
| Species Trypanosoma cruzi [TaxId:353153] [226636] (7 PDB entries) |
| Domain d6jktc1: 6jkt C:4-157 [381737] Other proteins in same PDB: d6jkta3, d6jktb3, d6jktd3, d6jkte3 automated match to d4iv5d1 complexed with gol, pal |
PDB Entry: 6jkt (more details), 2.3 Å
SCOPe Domain Sequences for d6jktc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jktc1 c.78.1.0 (C:4-157) automated matches {Trypanosoma cruzi [TaxId: 353153]}
lppvaslkgksitsaeqfsradiyalihlasamqrkidagevlnllqgrimtplffedss
rtfssfcaamirlggsvvnfkveassinkgetladtirtldsysdvlvmrhprqdaieea
lsvaqhpilnagngagehptqalldtltihselg
Timeline for d6jktc1: