SCOPe 2.04: Domain d1dlhd2: 1dlh D:3-81

Lineage for d1dlhd2 (1dlh D:3-81)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (18 PDB entries)
   Uniprot P01903 28-207

8. Domain d1dlhd2: 1dlh D:3-81 [38173]
   Other proteins in same PDB: d1dlha1, d1dlhb1, d1dlhb2, d1dlhd1, d1dlhe1, d1dlhe2
   complexed with nag, ndg

Details for d1dlhd2

PDB Entry: 1dlh, 2.8 Å

PDB Description: crystal structure of the human class ii mhc protein hla-dr1 complexed with an influenza virus peptide

PDB Compounds: (D:) class II histocompatibility antigen (hla-dr1) (alpha chain)

SCOPe Domain Sequences for d1dlhd2:

Sequence; same for both SEQRES and ATOM records:

>d1dlhd2 d.19.1.1 (D:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

Timeline for d1dlhd2:

• d1dlhd2 first appeared (with stable ids) in SCOP 1.55
  
• d1dlhd2 appears in SCOPe 2.03
  
• d1dlhd2 appears in SCOPe 2.05
  
• d1dlhd2 appears in the current release, SCOPe 2.08