Lineage for d6jktd1 (6jkt D:1-157)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513848Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2513849Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2514304Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2514305Protein automated matches [226938] (26 species)
    not a true protein
  7. 2514597Species Trypanosoma cruzi [TaxId:353153] [226636] (7 PDB entries)
  8. 2514663Domain d6jktd1: 6jkt D:1-157 [381729]
    Other proteins in same PDB: d6jkta3, d6jktb3, d6jktd3, d6jkte3
    automated match to d4iv5d1
    complexed with gol, pal

Details for d6jktd1

PDB Entry: 6jkt (more details), 2.3 Å

PDB Description: crystal structure of aspartate transcarbamoylase from trypanosoma cruzi in complex with n-(phosphonacetyl)-l-aspartic acid (pala).
PDB Compounds: (D:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d6jktd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jktd1 c.78.1.0 (D:1-157) automated matches {Trypanosoma cruzi [TaxId: 353153]}
mlelppvaslkgksitsaeqfsradiyalihlasamqrkidagevlnllqgrimtplffe
dssrtfssfcaamirlggsvvnfkveassinkgetladtirtldsysdvlvmrhprqdai
eealsvaqhpilnagngagehptqalldtltihselg

SCOPe Domain Coordinates for d6jktd1:

Click to download the PDB-style file with coordinates for d6jktd1.
(The format of our PDB-style files is described here.)

Timeline for d6jktd1: