Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins) contains Pfam PF00788 and Pfam PF02196 |
Protein c-Raf1 RBD [54264] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54265] (8 PDB entries) |
Domain d6ntcb_: 6ntc B: [381723] Other proteins in same PDB: d6ntca1, d6ntca2 automated match to d4g0nb_ complexed with gnp, gol, mg |
PDB Entry: 6ntc (more details), 2.9 Å
SCOPe Domain Sequences for d6ntcb_:
Sequence, based on SEQRES records: (download)
>d6ntcb_ d.15.1.5 (B:) c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} ntirvllpnqewtvvkvrngmslhdslmkalkrhglqpessavfrllhehkgkkarldwn tdaasligeelqvdf
>d6ntcb_ d.15.1.5 (B:) c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} ntirvllpnqewtvvkvmslhdslmkalkrhglqpessavfkarldwntdaasligeelq vdf
Timeline for d6ntcb_: