Lineage for d6of7a2 (6of7 A:206-491)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721241Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 2721242Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (2 families) (S)
    automatically mapped to Pfam PF03441
  5. 2721243Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (3 proteins)
  6. 2721265Protein Cryptochrome C-terminal domain [81841] (3 species)
  7. 2721266Species Mouse (Mus musculus) [TaxId:10090] [226830] (12 PDB entries)
  8. 2721283Domain d6of7a2: 6of7 A:206-491 [381721]
    Other proteins in same PDB: d6of7a1
    automated match to d4k0ra2

Details for d6of7a2

PDB Entry: 6of7 (more details), 3.11 Å

PDB Description: crystal structure of the cry1-per2 complex
PDB Compounds: (A:) Cryptochrome-1

SCOPe Domain Sequences for d6of7a2:

Sequence, based on SEQRES records: (download)

>d6of7a2 a.99.1.1 (A:206-491) Cryptochrome C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
ssavwpggetealtrlerhlerkawvanferprmnansllasptglspylrfgclscrlf
yfkltdlykkvkknsspplslygqllwreffytaatnnprfdkmegnpicvqipwdknpe
alakwaegrtgfpwidaimtqlrqegwihhlarhavacfltrgdlwisweegmkvfeell
ldadwsinagswmwlscssffqqffhcycpvgfgrrtdpngdyirrylpvlrgfpakyiy
dpwnapegiqkvakcligvnypkpmvnhaeasrlniermkqiyqql

Sequence, based on observed residues (ATOM records): (download)

>d6of7a2 a.99.1.1 (A:206-491) Cryptochrome C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
ssavwpggetealtrlerhlerkansllasptglspylrfgclscrlfyfkltdlykkvk
knsspplslygqllwreffytaatnnprfdkmegnpicvqipwdknpealakwaegrtgf
pwidaimtqlrqegwihhlarhavacfltrgdlwisweegmkvfeellldadwsinagsw
mwlscssffqqffhcycpvgfgrrtdpngdyirrylpvlrgfpakyiydpwnapegiqkv
akcligvnypkpmvnhaeasrlniermkqiyqql

SCOPe Domain Coordinates for d6of7a2:

Click to download the PDB-style file with coordinates for d6of7a2.
(The format of our PDB-style files is described here.)

Timeline for d6of7a2: