Lineage for d6l6ca_ (6l6c A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779190Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2779456Protein automated matches [190029] (6 species)
    not a true protein
  7. 2779464Species Human (Homo sapiens) [TaxId:9606] [186749] (38 PDB entries)
  8. 2779481Domain d6l6ca_: 6l6c A: [381706]
    automated match to d1g86a_
    complexed with 64k

Details for d6l6ca_

PDB Entry: 6l6c (more details), 1.77 Å

PDB Description: x-ray structure of human galectin-10 in complex with d-arabinose
PDB Compounds: (A:) Galectin-10

SCOPe Domain Sequences for d6l6ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l6ca_ b.29.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcfgr
rvvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpea
vkmvqvwrdisltkfnvsyl

SCOPe Domain Coordinates for d6l6ca_:

Click to download the PDB-style file with coordinates for d6l6ca_.
(The format of our PDB-style files is described here.)

Timeline for d6l6ca_: