Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
Protein automated matches [190029] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186749] (38 PDB entries) |
Domain d6l6ca_: 6l6c A: [381706] automated match to d1g86a_ complexed with 64k |
PDB Entry: 6l6c (more details), 1.77 Å
SCOPe Domain Sequences for d6l6ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6l6ca_ b.29.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} msllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcfgr rvvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpea vkmvqvwrdisltkfnvsyl
Timeline for d6l6ca_: