SCOPe 2.04: Domain d1fytb2: 1fyt B:3-92

Lineage for d1fytb2 (1fyt B:3-92)

Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimeric
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (17 PDB entries)
Domain d1fytb2: 1fyt B:3-92 [38170]
Other proteins in same PDB: d1fyta1, d1fyta2, d1fytb1, d1fytd1, d1fytd2, d1fyte1, d1fyte2
complexed with nag

Details for d1fytb2

PDB Entry: 1fyt (more details), 2.6 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr1

PDB Compounds: (B:) hla class II histocompatibility antigen, dr-1 beta chain

SCOPe Domain Sequences for d1fytb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fytb2 d.19.1.1 (B:3-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
trprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywn
sqkdlleqrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d1fytb2:

Click to download the PDB-style file with coordinates for d1fytb2.
(The format of our PDB-style files is described here.)

Timeline for d1fytb2: