Lineage for d1fytb2 (1fyt B:3-92)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190293Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 190294Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 190295Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 190467Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species)
  7. 190474Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [54460] (9 PDB entries)
  8. 190496Domain d1fytb2: 1fyt B:3-92 [38170]
    Other proteins in same PDB: d1fyta1, d1fytb1, d1fytd1, d1fytd2, d1fyte1, d1fyte2

Details for d1fytb2

PDB Entry: 1fyt (more details), 2.6 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr1

SCOP Domain Sequences for d1fytb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fytb2 d.19.1.1 (B:3-92) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
trprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywn
sqkdlleqrraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1fytb2:

Click to download the PDB-style file with coordinates for d1fytb2.
(The format of our PDB-style files is described here.)

Timeline for d1fytb2: