Lineage for d1fyta2 (1fyt A:2-81)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2183231Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 2183241Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (18 PDB entries)
    Uniprot P01903 28-207
  8. 2183261Domain d1fyta2: 1fyt A:2-81 [38169]
    Other proteins in same PDB: d1fyta1, d1fytb1, d1fytb2, d1fytd1, d1fytd2, d1fyte1, d1fyte2
    complexed with nag

Details for d1fyta2

PDB Entry: 1fyt (more details), 2.6 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr1
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1fyta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyta2 d.19.1.1 (A:2-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
keehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgala
niavdkanleimtkrsnytp

SCOPe Domain Coordinates for d1fyta2:

Click to download the PDB-style file with coordinates for d1fyta2.
(The format of our PDB-style files is described here.)

Timeline for d1fyta2: