SCOPe 2.08: Domain d6jksb2: 6jks B:158-326

Lineage for d6jksb2 (6jks B:158-326)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (26 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:353153] [226636] (8 PDB entries)

8. Domain d6jksb2: 6jks B:158-326 [381682]
   Other proteins in same PDB: d6jksb3, d6jksc3, d6jksd3, d6jksf3
   automated match to d4iv5a2
   complexed with asp, cp

Details for d6jksb2

PDB Entry: 6jks, 2.1 Å

PDB Description: crystal structure of aspartate transcarbamoylase from trypanosoma cruzi in complex with carbamoyl phosphate (cp) and aspartate (asp)

PDB Compounds: (B:) Aspartate carbamoyltransferase, putative

SCOPe Domain Sequences for d6jksb2:

Sequence, based on SEQRES records:

>d6jksb2 c.78.1.0 (B:158-326) automated matches {Trypanosoma cruzi [TaxId: 353153]}
svdgitialigdlkmgrtvhsllkllvrnfsikcvflvapdalqmpqdvleplqheiatk
gviihrthaltdevmqksdvlyttrlqkerfmastsddaaalqsfaakaditidaarmrl
akekmivmhplprndelsttvdadpraayfrqmrygmfmrmailwsvla

Sequence, based on observed residues (ATOM records):

>d6jksb2 c.78.1.0 (B:158-326) automated matches {Trypanosoma cruzi [TaxId: 353153]}
svdgitialigdlkmgrtvhsllkllvrnfsikcvflvapdalqmpqdvleplqheiatk
gviihrthaltdevmqksdvlyttrlqaditidaarmrlakekmivmhplprndelsttv
dadpraayfrqmrygmfmrmailwsvla

Timeline for d6jksb2:

• d6jksb2 first appeared in SCOPe 2.07