![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
![]() | Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (18 PDB entries) |
![]() | Domain d2sebb2: 2seb B:2-92 [38168] Other proteins in same PDB: d2seba1, d2seba2, d2sebb1, d2sebd1, d2sebd2 complexed with nag |
PDB Entry: 2seb (more details), 2.5 Å
SCOPe Domain Sequences for d2sebb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2sebb2 d.19.1.1 (B:2-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]} dtrprfleqvkhechffngtervrfldryfyhqeeyvrfdsdvgeyravtelgrpdaeyw nsqkdlleqkraavdtycrhnygvgesftvq
Timeline for d2sebb2:
![]() Domains from other chains: (mouse over for more information) d2seba1, d2seba2, d2sebd1, d2sebd2 |