| Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins) |
| Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (9 species) |
| Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [54460] (5 PDB entries) |
| Domain d2sebb2: 2seb B:2-92 [38168] Other proteins in same PDB: d2seba1, d2sebb1, d2sebd1, d2sebd2 |
PDB Entry: 2seb (more details), 2.5 Å
SCOP Domain Sequences for d2sebb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2sebb2 d.19.1.1 (B:2-92) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
dtrprfleqvkhechffngtervrfldryfyhqeeyvrfdsdvgeyravtelgrpdaeyw
nsqkdlleqkraavdtycrhnygvgesftvq
Timeline for d2sebb2:
View in 3DDomains from other chains: (mouse over for more information) d2seba1, d2seba2, d2sebd1, d2sebd2 |