Lineage for d6jkrf1 (6jkr F:2-157)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906884Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2906885Protein automated matches [226938] (26 species)
    not a true protein
  7. 2907177Species Trypanosoma cruzi [TaxId:353153] [226636] (8 PDB entries)
  8. 2907188Domain d6jkrf1: 6jkr F:2-157 [381679]
    Other proteins in same PDB: d6jkra3, d6jkrb3, d6jkrd3, d6jkre3
    automated match to d4iv5d1
    complexed with cp, gol

Details for d6jkrf1

PDB Entry: 6jkr (more details), 1.6 Å

PDB Description: crystal structure of aspartate transcarbamoylase from trypanosoma cruzi in complex with carbamoyl phosphate (cp)
PDB Compounds: (F:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d6jkrf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jkrf1 c.78.1.0 (F:2-157) automated matches {Trypanosoma cruzi [TaxId: 353153]}
lelppvaslkgksitsaeqfsradiyalihlasamqrkidagevlnllqgrimtplffed
ssrtfssfcaamirlggsvvnfkveassinkgetladtirtldsysdvlvmrhprqdaie
ealsvaqhpilnagngagehptqalldtltihselg

SCOPe Domain Coordinates for d6jkrf1:

Click to download the PDB-style file with coordinates for d6jkrf1.
(The format of our PDB-style files is described here.)

Timeline for d6jkrf1: