![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
![]() | Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
![]() | Protein automated matches [226938] (26 species) not a true protein |
![]() | Species Trypanosoma cruzi [TaxId:353153] [226636] (8 PDB entries) |
![]() | Domain d6jkre2: 6jkr E:158-326 [381665] Other proteins in same PDB: d6jkra3, d6jkrb3, d6jkrd3, d6jkre3 automated match to d4iv5a2 complexed with cp, gol |
PDB Entry: 6jkr (more details), 1.6 Å
SCOPe Domain Sequences for d6jkre2:
Sequence, based on SEQRES records: (download)
>d6jkre2 c.78.1.0 (E:158-326) automated matches {Trypanosoma cruzi [TaxId: 353153]} svdgitialigdlkmgrtvhsllkllvrnfsikcvflvapdalqmpqdvleplqheiatk gviihrthaltdevmqksdvlyttrlqkerfmastsddaaalqsfaakaditidaarmrl akekmivmhplprndelsttvdadpraayfrqmrygmfmrmailwsvla
>d6jkre2 c.78.1.0 (E:158-326) automated matches {Trypanosoma cruzi [TaxId: 353153]} svdgitialigdlkmgrtvhsllkllvrnfsikcvflvapdalqmpqdvleplqheiatk gviihrthaltdevmqksdvlyttrlqkaditidaarmrlakekmivmhplprndelstt vdadpraayfrqmrygmfmrmailwsvla
Timeline for d6jkre2: