SCOPe 2.08: Domain d6jfnb_: 6jfn B:

Lineage for d6jfnb_ (6jfn B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.0: automated matches [191587] (1 protein)
   not a true family

6. Protein automated matches [191055] (20 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [380338] (6 PDB entries)

8. Domain d6jfnb_: 6jfn B: [381645]
   automated match to d5kobc_
   complexed with lhy, ni

Details for d6jfnb_

PDB Entry: 6jfn, 2.04 Å

PDB Description: k4u bound crystal structure of class i type b peptide deformylase from pseudomonas aeruginosa

PDB Compounds: (B:) Peptide deformylase

SCOPe Domain Sequences for d6jfnb_:

Sequence, based on SEQRES records:

>d6jfnb_ d.167.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ireilkmgderllriaqpvpsellgseelqrliddmfetmhhvggvglaapqigvdlqlv
ifgferserypdapavpptillnpritplddemeegwegclsvpglrgavsrhrriryqg
ldpqgqpidrsvegfharvvqhecdhligrlypsritdfskfgftevl

Sequence, based on observed residues (ATOM records):

>d6jfnb_ d.167.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ireilkmgderllriaqpvpsellgseelqrliddmfetmhhvggvglaapqigvdlqlv
ifgfpavpptillnpritplddemeegwegclsvpglrgavsrhrriryqgldpqgqpid
rsvegfharvvqhecdhligrlypsritdfskfgftevl

Timeline for d6jfnb_:

• d6jfnb_ first appeared in SCOPe 2.07