Lineage for d1aqdg2 (1aqd G:3-81)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719728Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 719738Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (15 PDB entries)
  8. 719746Domain d1aqdg2: 1aqd G:3-81 [38163]
    Other proteins in same PDB: d1aqda1, d1aqdb1, d1aqdb2, d1aqdd1, d1aqde1, d1aqde2, d1aqdg1, d1aqdh1, d1aqdh2, d1aqdj1, d1aqdk1, d1aqdk2

Details for d1aqdg2

PDB Entry: 1aqd (more details), 2.45 Å

PDB Description: hla-dr1 (dra, drb1 0101) human class ii histocompatibility protein (extracellular domain) complexed with endogenous peptide
PDB Compounds: (G:) hla-dr1 class II histocompatibility protein

SCOP Domain Sequences for d1aqdg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqdg2 d.19.1.1 (G:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

SCOP Domain Coordinates for d1aqdg2:

Click to download the PDB-style file with coordinates for d1aqdg2.
(The format of our PDB-style files is described here.)

Timeline for d1aqdg2: