SCOPe 2.07: Domain d6i5db1: 6i5d B:23-264

Lineage for d6i5db1 (6i5d B:23-264)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [225260] (109 PDB entries)

8. Domain d6i5db1: 6i5d B:23-264 [381622]
   Other proteins in same PDB: d6i5da2, d6i5db2
   automated match to d4s2kb_
   complexed with cl, edo, gol, no3, peg, po4; mutant

Details for d6i5db1

PDB Entry: 6i5d, 1.75 Å

PDB Description: crystal structure of an oxa-48 beta-lactamase synthetic mutant

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d6i5db1:

Sequence; same for both SEQRES and ATOM records:

>d6i5db1 e.3.1.0 (B:23-264) automated matches {Klebsiella pneumoniae [TaxId: 573]}
kewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnsliald
lgvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhaf
dygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangd
yiiraktgystriekigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqeki
ip

Timeline for d6i5db1:

• d6i5db1 is new in SCOPe 2.07-stable
  
• d6i5db1 appears in the current release, SCOPe 2.08