Lineage for d1aqde2 (1aqd E:4-92)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897932Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 1897942Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (17 PDB entries)
  8. 1897949Domain d1aqde2: 1aqd E:4-92 [38162]
    Other proteins in same PDB: d1aqda1, d1aqda2, d1aqdb1, d1aqdd1, d1aqdd2, d1aqde1, d1aqdg1, d1aqdg2, d1aqdh1, d1aqdj1, d1aqdj2, d1aqdk1

Details for d1aqde2

PDB Entry: 1aqd (more details), 2.45 Å

PDB Description: hla-dr1 (dra, drb1 0101) human class ii histocompatibility protein (extracellular domain) complexed with endogenous peptide
PDB Compounds: (E:) hla-dr1 class II histocompatibility protein

SCOPe Domain Sequences for d1aqde2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqde2 d.19.1.1 (E:4-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
rprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywns
qkdlleqrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d1aqde2:

Click to download the PDB-style file with coordinates for d1aqde2.
(The format of our PDB-style files is described here.)

Timeline for d1aqde2: