SCOPe 2.08: Domain d6vd0c1: 6vd0 C:1-103

Lineage for d6vd0c1 (6vd0 C:1-103)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
   duplication: consists of 3 similar intertwined domains
   structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta

4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families)

5. Family d.130.1.0: automated matches [254267] (1 protein)
   not a true family

6. Protein automated matches [254617] (15 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [381544] (6 PDB entries)

8. Domain d6vd0c1: 6vd0 C:1-103 [381617]
   automated match to d1mxaa1
   complexed with apc, k, met, mg, mpo, peg, pg4

Details for d6vd0c1

PDB Entry: 6vd0, 2 Å

PDB Description: crystal structure of arabidopsis thaliana s-adenosylmethionine synthase 2 (atmat2) in complex with free methionine and ampcpp

PDB Compounds: (C:) S-adenosylmethionine synthase 2

SCOPe Domain Sequences for d6vd0c1:

Sequence; same for both SEQRES and ATOM records:

>d6vd0c1 d.130.1.0 (C:1-103) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
metflftsesvneghpdklcdqisdavldacleqdpdskvacetctktnmvmvfgeittk
atidyekivrdtcrsigfisddvgldadkckvlvnieqqspdi

Timeline for d6vd0c1:

• d6vd0c1 first appeared in SCOPe 2.07