Lineage for d6vd0c1 (6vd0 C:1-103)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976292Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2976293Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2976427Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2976428Protein automated matches [254617] (15 species)
    not a true protein
  7. 2976692Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [381544] (6 PDB entries)
  8. 2976723Domain d6vd0c1: 6vd0 C:1-103 [381617]
    automated match to d1mxaa1
    complexed with apc, k, met, mg, mpo, peg, pg4

Details for d6vd0c1

PDB Entry: 6vd0 (more details), 2 Å

PDB Description: crystal structure of arabidopsis thaliana s-adenosylmethionine synthase 2 (atmat2) in complex with free methionine and ampcpp
PDB Compounds: (C:) S-adenosylmethionine synthase 2

SCOPe Domain Sequences for d6vd0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vd0c1 d.130.1.0 (C:1-103) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
metflftsesvneghpdklcdqisdavldacleqdpdskvacetctktnmvmvfgeittk
atidyekivrdtcrsigfisddvgldadkckvlvnieqqspdi

SCOPe Domain Coordinates for d6vd0c1:

Click to download the PDB-style file with coordinates for d6vd0c1.
(The format of our PDB-style files is described here.)

Timeline for d6vd0c1: