SCOP 1.69: Domain d1hdmb2: 1hdm B:3-87

Lineage for d1hdmb2 (1hdm B:3-87)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DM [TaxId:9606] [88820] (1 PDB entry)

8. Domain d1hdmb2: 1hdm B:3-87 [38158]
   Other proteins in same PDB: d1hdma1, d1hdma2, d1hdmb1

Details for d1hdmb2

PDB Entry: 1hdm, 2.5 Å

PDB Description: histocompatibility antigen hla-dm

SCOP Domain Sequences for d1hdmb2:

Sequence; same for both SEQRES and ATOM records:

>d1hdmb2 d.19.1.1 (B:3-87) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DM}
fvahvestcllddagtpkdftycisfnkdlltcwdpeenkmapcnslanvlsqhlnqkdt
lmqrlnglqncathtqpfwgsltnr

Timeline for d1hdmb2:

• d1hdmb2 first appeared (with stable ids) in SCOP 1.55
  
• d1hdmb2 appears in SCOP 1.67
  
• d1hdmb2 appears in SCOP 1.71
  
• d1hdmb2 appears in the current release, SCOPe 2.08