Lineage for d1cd1c2 (1cd1 C:7-185)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600225Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 600226Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 600227Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 600228Protein CD1, alpha-1 and alpha-2 domains [54456] (3 species)
    Class I MHC-related
  7. 600236Species Mouse (Mus musculus) [TaxId:10090] [54457] (1 PDB entry)
  8. 600238Domain d1cd1c2: 1cd1 C:7-185 [38156]
    Other proteins in same PDB: d1cd1a1, d1cd1b_, d1cd1c1, d1cd1d_

Details for d1cd1c2

PDB Entry: 1cd1 (more details), 2.67 Å

PDB Description: cd1(mouse) antigen presenting molecule

SCOP Domain Sequences for d1cd1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cd1c2 d.19.1.1 (C:7-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus)}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOP Domain Coordinates for d1cd1c2:

Click to download the PDB-style file with coordinates for d1cd1c2.
(The format of our PDB-style files is described here.)

Timeline for d1cd1c2: