Lineage for d1cd1c2 (1cd1 C:7-185)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937553Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 2937606Species Mouse (Mus musculus) [TaxId:10090] [54457] (25 PDB entries)
  8. 2937622Domain d1cd1c2: 1cd1 C:7-185 [38156]
    Other proteins in same PDB: d1cd1a1, d1cd1b_, d1cd1c1, d1cd1d_

Details for d1cd1c2

PDB Entry: 1cd1 (more details), 2.67 Å

PDB Description: cd1(mouse) antigen presenting molecule
PDB Compounds: (C:) cd1

SCOPe Domain Sequences for d1cd1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cd1c2 d.19.1.1 (C:7-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d1cd1c2:

Click to download the PDB-style file with coordinates for d1cd1c2.
(The format of our PDB-style files is described here.)

Timeline for d1cd1c2: