SCOPe 2.07: Domain d6uh8b_: 6uh8 B:

Lineage for d6uh8b_ (6uh8 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (124 species)
   not a true protein

7. Species Petunia hybrida [TaxId:4102] [256236] (7 PDB entries)

8. Domain d6uh8b_: 6uh8 B: [381556]
   automated match to d4dnqi_
   complexed with gol, mes, mg, so4; mutant

Details for d6uh8b_

PDB Entry: 6uh8, 1.58 Å

PDB Description: crystal structure of dad2 n242i mutant

PDB Compounds: (B:) Decreased Apical Dominance 2

SCOPe Domain Sequences for d6uh8b_:

Sequence; same for both SEQRES and ATOM records:

>d6uh8b_ c.69.1.0 (B:) automated matches {Petunia hybrida [TaxId: 4102]}
gqtlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsvnpd
ffdfrryttldpyvddllhildalgidqcayvghsvsamigilasirrpelfskliliga
sprflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtlfnm
rpditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntvhwl
iieghlphlsaptllaqelrrals

Timeline for d6uh8b_:

• d6uh8b_ is new in SCOPe 2.07-stable
  
• d6uh8b_ appears in the current release, SCOPe 2.08