Lineage for d6vd1a3 (6vd1 A:240-392)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976292Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2976293Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2976427Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2976428Protein automated matches [254617] (15 species)
    not a true protein
  7. 2976692Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [381544] (6 PDB entries)
  8. 2976698Domain d6vd1a3: 6vd1 A:240-392 [381554]
    Other proteins in same PDB: d6vd1a4, d6vd1b4
    automated match to d1mxaa3
    complexed with 1pe, edo, k, mg, mpo, pdo, pe8, pge, pgr, ppk, sam

Details for d6vd1a3

PDB Entry: 6vd1 (more details), 1.32 Å

PDB Description: crystal structure of arabidopsis thaliana s-adenosylmethionine synthase 2 (atmat2) in complex with s-adenosylmethionine and ppnp
PDB Compounds: (A:) S-adenosylmethionine synthase 2

SCOPe Domain Sequences for d6vd1a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vd1a3 d.130.1.0 (A:240-392) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
iggphgdagltgrkiiidtyggwgahgggafsgkdptkvdrsgayivrqaaksvvangma
rralvqvsyaigvpeplsvfvdtygtglipdkeilkivketfdfrpgmmtinldlkrggn
grfqktaayghfgrddpdftwevvkplkwdkpq

SCOPe Domain Coordinates for d6vd1a3:

Click to download the PDB-style file with coordinates for d6vd1a3.
(The format of our PDB-style files is described here.)

Timeline for d6vd1a3: