| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) ![]() |
| Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
| Protein automated matches [254617] (15 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [381544] (6 PDB entries) |
| Domain d6vd1a3: 6vd1 A:240-392 [381554] Other proteins in same PDB: d6vd1a4, d6vd1b4 automated match to d1mxaa3 complexed with 1pe, edo, k, mg, mpo, pdo, pe8, pge, pgr, ppk, sam |
PDB Entry: 6vd1 (more details), 1.32 Å
SCOPe Domain Sequences for d6vd1a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vd1a3 d.130.1.0 (A:240-392) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
iggphgdagltgrkiiidtyggwgahgggafsgkdptkvdrsgayivrqaaksvvangma
rralvqvsyaigvpeplsvfvdtygtglipdkeilkivketfdfrpgmmtinldlkrggn
grfqktaayghfgrddpdftwevvkplkwdkpq
Timeline for d6vd1a3:
View in 3DDomains from other chains: (mouse over for more information) d6vd1b1, d6vd1b2, d6vd1b3, d6vd1b4 |