![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins) |
![]() | Protein CD1, alpha-1 and alpha-2 domains [54456] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [54457] (1 PDB entry) |
![]() | Domain d1cd1a2: 1cd1 A:7-185 [38155] Other proteins in same PDB: d1cd1a1, d1cd1b_, d1cd1c1, d1cd1d_ |
PDB Entry: 1cd1 (more details), 2.67 Å
SCOP Domain Sequences for d1cd1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cd1a2 d.19.1.1 (A:7-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus)} nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
Timeline for d1cd1a2:
![]() Domains from other chains: (mouse over for more information) d1cd1b_, d1cd1c1, d1cd1c2, d1cd1d_ |