Lineage for d6sxva1 (6sxv A:3-17,A:385-501)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810765Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
    interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain
  6. 2810766Protein Alpha-l-arabinofuranosidase [101924] (2 species)
    glycosyl hydrolase family 51
  7. 2810767Species Bacillus stearothermophilus [TaxId:1422] [101925] (5 PDB entries)
  8. 2810770Domain d6sxva1: 6sxv A:3-17,A:385-501 [381530]
    Other proteins in same PDB: d6sxva2, d6sxvb2
    automated match to d1pz3a1
    complexed with ete, gol, lxe, peg, pge

Details for d6sxva1

PDB Entry: 6sxv (more details), 1.4 Å

PDB Description: gh51 a-l-arabinofuranosidase soaked with aziridine inhibitor
PDB Compounds: (A:) GH51 a-l-arabinofuranosidase

SCOPe Domain Sequences for d6sxva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sxva1 b.71.1.2 (A:3-17,A:385-501) Alpha-l-arabinofuranosidase {Bacillus stearothermophilus [TaxId: 1422]}
tkkatmiiekdfkiaXgvalhpvisspkydskdftdvpylesiavyneekeevtifavnr
dmedalllecdvrsfedyrviehivlehdnvkqtnsaqsspvvphrngdaqlsdrkvsat
lpklswnvirlgk

SCOPe Domain Coordinates for d6sxva1:

Click to download the PDB-style file with coordinates for d6sxva1.
(The format of our PDB-style files is described here.)

Timeline for d6sxva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6sxva2