Class b: All beta proteins [48724] (178 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.8: AbfB domain [110221] (2 families) automatically mapped to Pfam PF05270 |
Species Aspergillus kawachii [TaxId:1033177] [381511] (2 PDB entries) |
Domain d6sxra2: 6sxr A:338-498 [381529] Other proteins in same PDB: d6sxra1 automated match to d1wd3a2 complexed with 1pe, act, edo, khp, nag, peg, pge, so4; mutant |
PDB Entry: 6sxr (more details), 1.64 Å
SCOPe Domain Sequences for d6sxra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6sxra2 b.42.8.0 (A:338-498) automated matches {Aspergillus kawachii [TaxId: 1033177]} lvsgpsftsgevvslrvttpgyttryiahtdttvntqvvdddssttlkeeaswtvvtgla nsqcfsfesvdtpgsyirhynfelllnandgtkqfhedatfcpqaalngegtslrswsyp tryfrhyenvlyaasnggvqtfdsktsfnndvsfeietafa
Timeline for d6sxra2: