SCOPe 2.07: Domain d6sxra1: 6sxr A:18-337

Lineage for d6sxra1 (6sxr A:18-337)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.21: Alpha-L-arabinofuranosidase B, N-terminal domain [110143] (2 proteins)
   automatically mapped to Pfam PF09206

6. Protein automated matches [254503] (2 species)
   not a true protein

7. Species Aspergillus kawachii [TaxId:1033177] [381509] (2 PDB entries)

8. Domain d6sxra1: 6sxr A:18-337 [381528]
   Other proteins in same PDB: d6sxra2
   automated match to d1wd3a1
   complexed with 1pe, act, edo, khp, nag, peg, pge, so4; mutant

Details for d6sxra1

PDB Entry: 6sxr, 1.64 Å

PDB Description: e221q mutant of gh54 a-l-arabinofuranosidase soaked with 4-nitrophenyl a-l-arabinofuranoside

PDB Compounds: (A:) alpha-L-arabinofuranosidase B

SCOPe Domain Sequences for d6sxra1:

Sequence; same for both SEQRES and ATOM records:

>d6sxra1 b.29.1.21 (A:18-337) automated matches {Aspergillus kawachii [TaxId: 1033177]}
mgpcdiyeagdtpcvaahsttralyssfsgalyqlqrgsddttttispltaggiadasaq
dtfcanttclitiiydqsgngnhltqappggfdgpdtdgydnlasaigapvtlngqkayg
vfmspgtgyrnneatgtatgdeaegmyavldgthyndaccfdygnaetsstdtgaghmea
iylgnsttwgygagdgpwimvdmqnnlfsgadegynsgdpsisyrfvtaavkggadkwai
rganaasgslstyysgarpdysgynpmskegaiilgiggdnsngaqgtfyegvmtsgyps
ddtensvqenivaakyvvgs

Timeline for d6sxra1:

• d6sxra1 is new in SCOPe 2.07-stable
  
• d6sxra1 appears in the current release, SCOPe 2.08