Lineage for d6sxra1 (6sxr A:18-337)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780511Family b.29.1.21: Alpha-L-arabinofuranosidase B, N-terminal domain [110143] (2 proteins)
    automatically mapped to Pfam PF09206
  6. 2780516Protein automated matches [254503] (2 species)
    not a true protein
  7. 2780517Species Aspergillus kawachii [TaxId:1033177] [381509] (2 PDB entries)
  8. 2780519Domain d6sxra1: 6sxr A:18-337 [381528]
    Other proteins in same PDB: d6sxra2
    automated match to d1wd3a1
    complexed with 1pe, act, edo, khp, nag, peg, pge, so4; mutant

Details for d6sxra1

PDB Entry: 6sxr (more details), 1.64 Å

PDB Description: e221q mutant of gh54 a-l-arabinofuranosidase soaked with 4-nitrophenyl a-l-arabinofuranoside
PDB Compounds: (A:) alpha-L-arabinofuranosidase B

SCOPe Domain Sequences for d6sxra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sxra1 b.29.1.21 (A:18-337) automated matches {Aspergillus kawachii [TaxId: 1033177]}
mgpcdiyeagdtpcvaahsttralyssfsgalyqlqrgsddttttispltaggiadasaq
dtfcanttclitiiydqsgngnhltqappggfdgpdtdgydnlasaigapvtlngqkayg
vfmspgtgyrnneatgtatgdeaegmyavldgthyndaccfdygnaetsstdtgaghmea
iylgnsttwgygagdgpwimvdmqnnlfsgadegynsgdpsisyrfvtaavkggadkwai
rganaasgslstyysgarpdysgynpmskegaiilgiggdnsngaqgtfyegvmtsgyps
ddtensvqenivaakyvvgs

SCOPe Domain Coordinates for d6sxra1:

Click to download the PDB-style file with coordinates for d6sxra1.
(The format of our PDB-style files is described here.)

Timeline for d6sxra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6sxra2