Lineage for d6sxvb2 (6sxv B:18-384)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2830562Protein Alpha-L-arabinofuranosidase, catalytic domain [102075] (2 species)
    glycosyl hydrolase family 51
  7. 2830563Species Bacillus stearothermophilus [TaxId:1422] [102076] (5 PDB entries)
  8. 2830567Domain d6sxvb2: 6sxv B:18-384 [381525]
    Other proteins in same PDB: d6sxva1, d6sxvb1
    automated match to d1pz3a2
    complexed with ete, gol, lxe, peg, pge

Details for d6sxvb2

PDB Entry: 6sxv (more details), 1.4 Å

PDB Description: gh51 a-l-arabinofuranosidase soaked with aziridine inhibitor
PDB Compounds: (B:) GH51 a-l-arabinofuranosidase

SCOPe Domain Sequences for d6sxvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sxvb2 c.1.8.3 (B:18-384) Alpha-L-arabinofuranosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]}
eidkriygsfiehlgravyggiyepghpqadengfrqdvielvkelqvpiirypggnfvs
gynwedgvgpkeqrprrldlawksvetneiglnefmdwakmvgaevnmavnlgtrgidaa
rnlveycnhpsgsyysdlriahgykephkiktwclgnemdgpwqighktaveygriacea
akvmkwvdptielvvcgssnrnmptfaeweatvldhtydhvdyislhqyygnrdndtany
lalslemddfirsvvaiadyvkakkrskktihlsfdewnvwyhsneadkliepwtvappl
lediynfedallvgcmlitlmkhadrvkiaclaqlvnviapimtekngpawkqtiyypfm
hasvygr

SCOPe Domain Coordinates for d6sxvb2:

Click to download the PDB-style file with coordinates for d6sxvb2.
(The format of our PDB-style files is described here.)

Timeline for d6sxvb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6sxvb1