Lineage for d3frue2 (3fru E:1-178)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1898068Protein Fc (IgG) receptor, alpha-1 and alpha-2 domains [54454] (2 species)
    class I MHC-related
  7. 1898071Species Norway rat (Rattus norvegicus) [TaxId:10116] [54455] (3 PDB entries)
  8. 1898074Domain d3frue2: 3fru E:1-178 [38152]
    Other proteins in same PDB: d3frua1, d3frub_, d3fruc1, d3frud_, d3frue1, d3fruf_
    complexed with bme, nag, so4

Details for d3frue2

PDB Entry: 3fru (more details), 2.2 Å

PDB Description: neonatal fc receptor, ph 6.5
PDB Compounds: (E:) neonatal fc receptor

SCOPe Domain Sequences for d3frue2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3frue2 d.19.1.1 (E:1-178) Fc (IgG) receptor, alpha-1 and alpha-2 domains {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aeprlplmyhlaavsdlstglpsfwatgwlgaqqyltynnlrqeadpcgawiwenqvswy
wekettdlkskeqlfleairtlenqingtftlqgllgcelapdnsslptavfalngeefm
rfnprtgnwsgewpetdivgnlwmkqpeaarkeseflltscperllghlergrqnlew

SCOPe Domain Coordinates for d3frue2:

Click to download the PDB-style file with coordinates for d3frue2.
(The format of our PDB-style files is described here.)

Timeline for d3frue2: