SCOP 1.67: Domain d3frue2: 3fru E:1-178

Lineage for d3frue2 (3fru E:1-178)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)

6. Protein Fc (IgG) receptor, alpha-1 and alpha-2 domains [54454] (2 species)
   class I MHC-related

7. Species Rat (Rattus norvegicus) [TaxId:10116] [54455] (3 PDB entries)

8. Domain d3frue2: 3fru E:1-178 [38152]
   Other proteins in same PDB: d3frua1, d3frub_, d3fruc1, d3frud_, d3frue1, d3fruf_
   complexed with bme, fuc, gal, man, nag, so4

Details for d3frue2

PDB Entry: 3fru, 2.2 Å

PDB Description: neonatal fc receptor, ph 6.5

SCOP Domain Sequences for d3frue2:

Sequence; same for both SEQRES and ATOM records:

>d3frue2 d.19.1.1 (E:1-178) Fc (IgG) receptor, alpha-1 and alpha-2 domains {Rat (Rattus norvegicus)}
aeprlplmyhlaavsdlstglpsfwatgwlgaqqyltynnlrqeadpcgawiwenqvswy
wekettdlkskeqlfleairtlenqingtftlqgllgcelapdnsslptavfalngeefm
rfnprtgnwsgewpetdivgnlwmkqpeaarkeseflltscperllghlergrqnlew

Timeline for d3frue2:

• d3frue2 first appeared (with stable ids) in SCOP 1.55
  
• d3frue2 appears in SCOP 1.65
  
• d3frue2 appears in SCOP 1.69
  
• d3frue2 appears in the current release, SCOPe 2.08