SCOP 1.59: Domain d3frue2: 3fru E:1-178

Lineage for d3frue2 (3fru E:1-178)

Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)
Family d.19.1.1: MHC antigen-recognition domain [54453] (9 proteins)
Protein Fc (IgG) receptor, alpha-1 and alpha-2 domains [54454] (1 species)
Species Rat (Rattus norvegicus) [TaxId:10116] [54455] (3 PDB entries)
Domain d3frue2: 3fru E:1-178 [38152]
Other proteins in same PDB: d3frua1, d3frub1, d3fruc1, d3frud1, d3frue1, d3fruf1

Details for d3frue2

PDB Entry: 3fru (more details), 2.2 Å

PDB Description: neonatal fc receptor, ph 6.5

SCOP Domain Sequences for d3frue2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3frue2 d.19.1.1 (E:1-178) Fc (IgG) receptor, alpha-1 and alpha-2 domains {Rat (Rattus norvegicus)}
aeprlplmyhlaavsdlstglpsfwatgwlgaqqyltynnlrqeadpcgawiwenqvswy
wekettdlkskeqlfleairtlenqingtftlqgllgcelapdnsslptavfalngeefm
rfnprtgnwsgewpetdivgnlwmkqpeaarkeseflltscperllghlergrqnlew

SCOP Domain Coordinates for d3frue2:

Click to download the PDB-style file with coordinates for d3frue2.
(The format of our PDB-style files is described here.)

Timeline for d3frue2: