Lineage for d6sxta2 (6sxt A:338-498)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2402468Superfamily b.42.8: AbfB domain [110221] (2 families) (S)
    automatically mapped to Pfam PF05270
  5. Family b.42.8.0: automated matches [254221] (1 protein)
    not a true family
  6. Protein automated matches [254504] (2 species)
    not a true protein
  7. 2402476Species Aspergillus kawachii [TaxId:1033177] [381511] (2 PDB entries)
  8. 2402477Domain d6sxta2: 6sxt A:338-498 [381512]
    Other proteins in same PDB: d6sxta1, d6sxta3
    automated match to d1wd3a2
    complexed with act, ala, edo, lxe, nag, peg, pge, so4

Details for d6sxta2

PDB Entry: 6sxt (more details), 1.47 Å

PDB Description: gh54 a-l-arabinofuranosidase soaked with aziridine inhibitor
PDB Compounds: (A:) alpha-L-arabinofuranosidase B

SCOPe Domain Sequences for d6sxta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sxta2 b.42.8.0 (A:338-498) automated matches {Aspergillus kawachii [TaxId: 1033177]}
lvsgpsftsgevvslrvttpgyttryiahtdttvntqvvdddssttlkeeaswtvvtgla
nsqcfsfesvdtpgsyirhynfelllnandgtkqfhedatfcpqaalngegtslrswsyp
tryfrhyenvlyaasnggvqtfdsktsfnndvsfeietafa

SCOPe Domain Coordinates for d6sxta2:

Click to download the PDB-style file with coordinates for d6sxta2.
(The format of our PDB-style files is described here.)

Timeline for d6sxta2: