Lineage for d6sbjb_ (6sbj B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004667Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. 3004668Superfamily d.177.1: FAH [56529] (2 families) (S)
  5. 3004669Family d.177.1.1: FAH [56530] (7 proteins)
    automatically mapped to Pfam PF01557
  6. 3004725Protein automated matches [191123] (4 species)
    not a true protein
  7. 3004758Species Mouse (Mus musculus) [TaxId:10090] [381497] (2 PDB entries)
  8. 3004760Domain d6sbjb_: 6sbj B: [381508]
    automated match to d1sawb_
    complexed with cl, mg

Details for d6sbjb_

PDB Entry: 6sbj (more details), 2.22 Å

PDB Description: x-ray structure of mus musculus fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) apo-form uuncomplexed
PDB Compounds: (B:) Acylpyruvase FAHD1, mitochondrial

SCOPe Domain Sequences for d6sbjb_:

Sequence, based on SEQRES records: (download)

>d6sbjb_ d.177.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ctmastkplsrfwewgknivcvgrnyadhvkemrstvlsepvlflkpstayapegspvlm
paycrnlhhevelgvllgkrgeaipeaaamdyvagyalcldmtardvqeeckkkglpwtl
aksftsscpvsafvpkekipdphalrlwlkvngelrqegktssmifsipyiisyvskiit
leegdliltgtpkgvgpikendeieagidgvvsmrfkvkrs

Sequence, based on observed residues (ATOM records): (download)

>d6sbjb_ d.177.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ctmastkplsrfwewgknivcvgrnytvlsepvlflkpstayapegspvlmpaycrnlhh
evelgvllgkrgeaipeaaamdyvagyalcldmtardvqeeckkkglpwtlaksftsscp
vsafvpkekipdphalrlwlkvngelrqegktssmifsipyiisyvskiitleegdlilt
gtpkgvgpikendeieagidgvvsmrfkvkrs

SCOPe Domain Coordinates for d6sbjb_:

Click to download the PDB-style file with coordinates for d6sbjb_.
(The format of our PDB-style files is described here.)

Timeline for d6sbjb_: