SCOPe 2.05: Domain d1pcfe_: 1pcf E:

Lineage for d1pcfe_ (1pcf E:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
   helix-swapped dimer of beta(4)-alpha motifs

4. Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families)

5. Family d.18.1.1: Transcriptional coactivator PC4 C-terminal domain [54448] (1 protein)
   dimer of two separate motifs
   automatically mapped to Pfam PF02229

6. Protein Transcriptional coactivator PC4 C-terminal domain [54449] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54450] (3 PDB entries)

8. Domain d1pcfe_: 1pcf E: [38146]

Details for d1pcfe_

PDB Entry: 1pcf, 1.74 Å

PDB Description: human transcriptional coactivator pc4 c-terminal domain

PDB Compounds: (E:) transcriptional coactivator pc4

SCOPe Domain Sequences for d1pcfe_:

Sequence; same for both SEQRES and ATOM records:

>d1pcfe_ d.18.1.1 (E:) Transcriptional coactivator PC4 C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
amfqigkmryvsvrdfkgkvlidireywmdpegemkpgrkgislnpeqwsqlkeqisdid
davrkl

Timeline for d1pcfe_:

• d1pcfe_ first appeared (with stable ids) in SCOP 1.55
  
• d1pcfe_ appears in SCOPe 2.04
  
• d1pcfe_ is called d1pcfe1 in SCOPe 2.06
  
• d1pcfe_ appears in the current release, SCOPe 2.08, called d1pcfe1