| Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
| Fold e.37: Siroheme synthase middle domains-like [75614] (1 superfamily) 2 domains: (1) alpha+beta, 2 layers; (2) 3/4-helical bundle, right-handed twist, left-handed superhelix |
Superfamily e.37.1: Siroheme synthase middle domains-like [75615] (2 families) ![]() |
| Family e.37.1.0: automated matches [381345] (1 protein) not a true family |
| Protein automated matches [381346] (1 species) not a true protein |
| Species Salmonella typhimurium [TaxId:90371] [381347] (9 PDB entries) |
| Domain d6pr4b2: 6pr4 B:114-215 [381419] Other proteins in same PDB: d6pr4a1, d6pr4a3, d6pr4b1, d6pr4b3 automated match to d1pjqa3 complexed with sah |
PDB Entry: 6pr4 (more details), 2.24 Å
SCOPe Domain Sequences for d6pr4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pr4b2 e.37.1.0 (B:114-215) automated matches {Salmonella typhimurium [TaxId: 90371]}
psiidrsplmvavsaggtspvlarllreklesllpqhlgqvaryagqlrarvkkqfatmg
errrfwekffvndrlaqslanadekavnatterlfsepldhr
Timeline for d6pr4b2: