SCOPe 2.08: Domain d6pqzb3: 6pqz B:216-455

Lineage for d6pqzb3 (6pqz B:216-455)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 5 strands, order 32415
   Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest

4. Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families)

5. Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
   Pfam PF00590

6. Protein automated matches [190790] (4 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [381349] (8 PDB entries)

8. Domain d6pqzb3: 6pqz B:216-455 [381410]
   Other proteins in same PDB: d6pqza1, d6pqza2, d6pqzb1, d6pqzb2
   automated match to d1pjqa2
   complexed with sah

Details for d6pqzb3

PDB Entry: 6pqz, 2.23 Å

PDB Description: p133g/s128a s. typhimurium siroheme synthase

PDB Compounds: (B:) Siroheme synthase

SCOPe Domain Sequences for d6pqzb3:

Sequence, based on SEQRES records:

>d6pqzb3 c.90.1.1 (B:216-455) automated matches {Salmonella typhimurium [TaxId: 90371]}
gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkragyh
cvpqeeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasg
csaysgiplthrdyaqsvrlvtghlktggeldwenlaaekqtlvfymglnqaatiqekli
afgmqadmpvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfs

Sequence, based on observed residues (ATOM records):

>d6pqzb3 c.90.1.1 (B:216-455) automated matches {Salmonella typhimurium [TaxId: 90371]}
gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkvpqee
inqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasgcsaysg
iplthrdyaqsvrlvtgggeldwenlaaekqtlvfymglnqaatiqekliafgmqadmpv
alvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfs

Timeline for d6pqzb3:

• d6pqzb3 first appeared in SCOPe 2.07