SCOP 1.63: Domain d1euid_: 1eui D:

Lineage for d1euid_ (1eui D:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.17: Cystatin-like [54402] (5 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family)
   has an additional strand at the C-terminus and a helix inserted after the first strand

5. Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)

6. Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species)

7. Species Bacteriophage pbs2 [TaxId:10684] [54445] (8 PDB entries)

8. Domain d1euid_: 1eui D: [38141]
   Other proteins in same PDB: d1euia_, d1euib_

Details for d1euid_

PDB Entry: 1eui, 3.2 Å

PDB Description: escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein

SCOP Domain Sequences for d1euid_:

Sequence; same for both SEQRES and ATOM records:

>d1euid_ d.17.5.1 (D:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2}
qlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsdapeykpwalviqd
sngenkikml

Timeline for d1euid_:

• d1euid_ first appeared (with stable ids) in SCOP 1.55
  
• d1euid_ appears in SCOP 1.61
  
• d1euid_ appears in SCOP 1.65
  
• d1euid_ appears in the current release, SCOPe 2.08