Lineage for d1euid_ (1eui D:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30954Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 31129Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) (S)
  5. 31130Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)
  6. 31131Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species)
  7. 31134Species Bacteriophage pbs2 [TaxId:10684] [54445] (6 PDB entries)
  8. 31151Domain d1euid_: 1eui D: [38141]
    Other proteins in same PDB: d1euia_, d1euib_

Details for d1euid_

PDB Entry: 1eui (more details), 3.2 Å

PDB Description: escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein
PDB Compounds: (D:)

SCOP Domain Sequences for d1euid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euid_ d.17.5.1 (D:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2}
qlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsdapeykpwalviqd
sngenkikml

SCOP Domain Coordinates for d1euid_:

Click to download the PDB-style file with coordinates for d1euid_.
(The format of our PDB-style files is described here.)

Timeline for d1euid_: