Lineage for d1euid_ (1eui D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2937388Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) (S)
    has an additional strand at the C-terminus and a helix inserted after the first strand
  5. 2937389Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)
  6. 2937390Protein Uracil-DNA glycosylase inhibitor protein [54443] (3 species)
  7. 2937395Species Bacteriophage pbs2 [TaxId:10684] [54445] (12 PDB entries)
  8. 2937429Domain d1euid_: 1eui D: [38141]
    Other proteins in same PDB: d1euia_, d1euib_
    protein/DNA complex

Details for d1euid_

PDB Entry: 1eui (more details), 3.2 Å

PDB Description: escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein
PDB Compounds: (D:) uracil-DNA glycosylase inhibitor protein

SCOPe Domain Sequences for d1euid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euid_ d.17.5.1 (D:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]}
qlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsdapeykpwalviqd
sngenkikml

SCOPe Domain Coordinates for d1euid_:

Click to download the PDB-style file with coordinates for d1euid_.
(The format of our PDB-style files is described here.)

Timeline for d1euid_: