Lineage for d6pqzb2 (6pqz B:114-215)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3020180Fold e.37: Siroheme synthase middle domains-like [75614] (1 superfamily)
    2 domains: (1) alpha+beta, 2 layers; (2) 3/4-helical bundle, right-handed twist, left-handed superhelix
  4. 3020181Superfamily e.37.1: Siroheme synthase middle domains-like [75615] (2 families) (S)
  5. 3020203Family e.37.1.0: automated matches [381345] (1 protein)
    not a true family
  6. 3020204Protein automated matches [381346] (1 species)
    not a true protein
  7. 3020205Species Salmonella typhimurium [TaxId:90371] [381347] (9 PDB entries)
  8. 3020215Domain d6pqzb2: 6pqz B:114-215 [381409]
    Other proteins in same PDB: d6pqza1, d6pqza3, d6pqzb1, d6pqzb3
    automated match to d1pjqa3
    complexed with sah

Details for d6pqzb2

PDB Entry: 6pqz (more details), 2.23 Å

PDB Description: p133g/s128a s. typhimurium siroheme synthase
PDB Compounds: (B:) Siroheme synthase

SCOPe Domain Sequences for d6pqzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pqzb2 e.37.1.0 (B:114-215) automated matches {Salmonella typhimurium [TaxId: 90371]}
psiidrsplmvavsaggtsgvlarllreklesllpqhlgqvaryagqlrarvkkqfatmg
errrfwekffvndrlaqslanadekavnatterlfsepldhr

SCOPe Domain Coordinates for d6pqzb2:

Click to download the PDB-style file with coordinates for d6pqzb2.
(The format of our PDB-style files is described here.)

Timeline for d6pqzb2: