| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Salmonella typhimurium [TaxId:90371] [381343] (9 PDB entries) |
| Domain d6pqzb1: 6pqz B:1-113 [381408] Other proteins in same PDB: d6pqza2, d6pqza3, d6pqzb2, d6pqzb3 automated match to d1pjqa1 complexed with sah |
PDB Entry: 6pqz (more details), 2.23 Å
SCOPe Domain Sequences for d6pqzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pqzb1 c.2.1.0 (B:1-113) automated matches {Salmonella typhimurium [TaxId: 90371]}
mdhlpifcqlrdrdclivgggdvaerkarllleagarltvnaltfipqftvwanegmltl
vegpfdetlldscwlaiaatdddtvnqrvsdaaesrrifcnvvdapkaasfim
Timeline for d6pqzb1: