![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) ![]() has an additional strand at the C-terminus and a helix inserted after the first strand |
![]() | Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein) |
![]() | Protein Uracil-DNA glycosylase inhibitor protein [54443] (3 species) |
![]() | Species Bacteriophage pbs2 [TaxId:10684] [54445] (12 PDB entries) |
![]() | Domain d1euic_: 1eui C: [38140] Other proteins in same PDB: d1euia_, d1euib_ protein/DNA complex |
PDB Entry: 1eui (more details), 3.2 Å
SCOPe Domain Sequences for d1euic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1euic_ d.17.5.1 (C:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]} qlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsdapeykpwalviqd sngenkikml
Timeline for d1euic_: