Lineage for d2uugd_ (2uug D:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.17: Cystatin-like [54402] (5 superfamilies) 
Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) 
Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein) Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species) Species Bacteriophage pbs2 [TaxId:10684] [54445] (6 PDB entries) 
Domain d2uugd_: 2uug D: [38139]
Other proteins in same PDB: d2uuga_, d2uugb_
Details for d2uugd_
PDB Entry: 2uug (more details), 2.6 Å
PDB Description: escherichia coli uracil-dna glycosylase:inhibitor complex with h187d mutant udg and wild-type ugi
SCOP Domain Sequences for d2uugd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uugd_ d.17.5.1 (D:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2}
nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
peykpwalviqdsngenkikml
SCOP Domain Coordinates for d2uugd_:
Click to download the PDB-style file with coordinates for d2uugd_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2uugd_:
- d2uugd_ appears in SCOP 1.57
- d2uugd_ appears in the current release, SCOPe 2.08
View in 3D
